Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50288192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157564 |
---|
Ki | 0.600000±n/a nM |
---|
Citation | Abbenante, G; Bergman, D; Brinkworth, R; March, D; Reid, R; Hunt, P; James, I; Dancer, R; Garnham, B; Stoermer, M; Fairlie, D Structure-activity relationships for macrocyclic peptidomimetic inhibitors of HIV-1 protease Bioorg Med Chem Lett6:2531-2536 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50288192 |
---|
n/a |
---|
Name | BDBM50288192 |
Synonyms: | CHEMBL83186 | N-[2-Hydroxy-2-((S)-8-isopropyl-6,9-dioxo-2-oxa-7,10-diaza-bicyclo[11.2.2]heptadeca-1(16),13(17),14-trien-11-yl)-ethyl]-N-(3-methyl-butyl)-benzenesulfonamide |
Type | Small organic molecule |
Emp. Form. | C29H40N4O7S |
Mol. Mass. | 588.716 |
SMILES | CC(C)CCN(C[C@@H](O)[C@H]1Cc2ccc(OCCCC(=O)N[C@@H](CC(N)=O)C(=O)N1)cc2)S(=O)(=O)c1ccccc1 |
Structure |
|