BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50290082
Substrate/Competitorn/a
Meas. Tech.ChEBML_195497
Ki 71±n/a nM
Citation Diaz PMichel SStella LCharpentier B Synthesis and biological activities of new heterocyclic aromatic retinoids Bioorg Med Chem Lett 7:2289-2294 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Synonyms:HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor beta
Type:PROTEIN
Mol. Mass.:50498.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1458015
Residue:455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290082
n/a
NameBDBM50290082
Synonyms:3-(3-Adamantan-1-yl-4-methoxy-phenyl)-2H-chromene-7-carboxylic acid | CHEMBL75732
TypeSmall organic molecule
Emp. Form.C27H28O4
Mol. Mass.416.5088
SMILESCOc1ccc(cc1C12C[C@H]3C[C@H](C[C@H](C3)C1)C2)C1=Cc2ccc(cc2OC1)C(O)=O |t:22,TLB:15:10:17:16.14.13,15:14:17:9.10.11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: