new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50061061
Substrate/Competitorn/a
Meas. Tech.ChEBML_92550
Ki 1340±n/a nM
Citation Dondio GRonzoni SPetrillo PDesJarlais RLRaveglia LF Pyrrolooctahydroisoquinolines as potent and selective opioid receptor ligands: SAR analysis and docking studies Bioorg Med Chem Lett 7:2967-2972 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:KOR-1 | MSL-1 | OPIATE Kappa | OPRK1
Type:Enzyme
Mol. Mass.:42656.78
Organism:Mus musculus (Mouse)
Description:P33534
Residue:380
Sequence:
MESPIQIFRGDPGPTCSPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLESAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061061
n/a
NameBDBM50061061
Synonyms:(4aR,8aS)-6-Ethyl-8a-(3-hydroxy-phenyl)-3-methyl-4,4a,5,6,7,8,8a,9-octahydro-1H-pyrrolo[2,3-g]isoquinoline-2-carboxylic acid diethylamide | CHEMBL100729
TypeSmall organic molecule
Emp. Form.C25H35N3O2
Mol. Mass.409.5643
SMILESCCN(CC)C(=O)c1[nH]c2C[C@]3(CCN(CC)C[C@@H]3Cc2c1C)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: