Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50421412
Substrate/Competitorn/a
Meas. Tech.ChEBML_151696
IC50 40±n/a nM
Citation Chen JZHu LHJiang HLGu JDZhu WLChen ZLChen KXJi RY A 3D-QSAR study on ginkgolides and their analogues with comparative molecular field analysis. Bioorg Med Chem Lett 8:1291-6 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50421412
n/a
NameBDBM50421412
Synonyms:CHEMBL2304167
TypeSmall organic molecule
Emp. Form.C28H32O11
Mol. Mass.544.5471
SMILESCC1C(=O)O[C@H]2[C@H](O)C34[C@H]5C[C@@H](C(C)(C)C)[C@]33[C@@H](OC(=O)[C@@H]3OCOCc3ccccc3)O[C@@]4(C(=O)O5)[C@@]12O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: