Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmepsin 2
LigandBDBM50146770
Substrate/Competitorn/a
Meas. Tech.ChEBML_154921
Ki 440±n/a nM
Citation Carroll CDPatel HJohnson TOGuo TOrlowski MHe ZMCavallaro CLGuo JOksman AGluzman IYConnelly JChelsky DGoldberg DEDolle RE Identification of potent inhibitors of Plasmodium falciparum plasmepsin II from an encoded statine combinatorial library. Bioorg Med Chem Lett 8:2315-20 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Plasmepsin 2
Name:Plasmepsin 2
Synonyms:Aspartic hemoglobinase II | PFAPD | Plasmepsin 2 (PM-II) | Plasmepsin-II
Type:Enzyme
Mol. Mass.:51482.09
Organism:Plasmodium falciparum
Description:P46925
Residue:453
Sequence:
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146770
n/a
NameBDBM50146770
Synonyms:CHEMBL94646 | N-(1-{1-[1-Hydroxy-2-(3-phenyl-propylcarbamoyl)-ethyl]-3-methyl-butylcarbamoyl}-2-methyl-butyl)-4-methylaminomethyl-benzamide | PS-222036
TypeSmall organic molecule
Emp. Form.C32H48N4O4
Mol. Mass.552.7479
SMILESCCC(C)C(NC(=O)c1ccc(CNC)cc1)C(=O)NC(CC(C)C)C(O)CC(=O)NCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: