Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmepsin 2
LigandBDBM50071551
Substrate/Competitorn/a
Meas. Tech.ChEBML_154921
Ki 500±n/a nM
Citation Carroll CDPatel HJohnson TOGuo TOrlowski MHe ZMCavallaro CLGuo JOksman AGluzman IYConnelly JChelsky DGoldberg DEDolle RE Identification of potent inhibitors of Plasmodium falciparum plasmepsin II from an encoded statine combinatorial library. Bioorg Med Chem Lett 8:2315-20 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Plasmepsin 2
Name:Plasmepsin 2
Synonyms:Aspartic hemoglobinase II | PFAPD | Plasmepsin 2 (PM-II) | Plasmepsin-II
Type:Enzyme
Mol. Mass.:51482.09
Organism:Plasmodium falciparum
Description:P46925
Residue:453
Sequence:
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071551
n/a
NameBDBM50071551
Synonyms:CHEMBL427946 | N-[(S)-1-(1-Benzyl-3-butylcarbamoyl-2-hydroxy-propylcarbamoyl)-2-methyl-propyl]-2,4-dimethoxy-benzamide | PS-725074
TypeSmall organic molecule
Emp. Form.C29H41N3O6
Mol. Mass.527.6523
SMILESCCCCNC(=O)CC(O)C(Cc1ccccc1)NC(=O)[C@@H](NC(=O)c1ccc(OC)cc1OC)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: