Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRPR
LigandBDBM50071733
Substrate/Competitorn/a
Meas. Tech.ChEBML_39763
Ki 0.040000±n/a nM
Citation Ashwood VBrownhill VHigginbottom MHorwell DCHughes JLewthwaite RAMcKnight ATPinnock RDPritchard MCSuman-Chauhan NWebb CWilliams SC PD 176252--the first high affinity non-peptide gastrin-releasing peptide (BB2) receptor antagonist. Bioorg Med Chem Lett 8:2589-94 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
GRPR
Name:Gastrin releasing peptide receptor
Synonyms:Bombesin 2 | GRP-R | GRP-preferring bombesin receptor | Gastrin-releasing peptide receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43214.53
Organism:Homo sapiens (Human)
Description:Bombesin 2 GRPR 0::P30550
Residue:384
Sequence:
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071733
n/a
NameBDBM50071733
Synonyms:CHEMBL413196 | Compound GRP
TypeSmall organic molecule
Emp. Form.C130H203N37O32S2
Mol. Mass.2860.362
SMILESCSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)C(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: