Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNMBR
LigandBDBM50071745
Substrate/Competitorn/a
Meas. Tech.ChEBML_39622
Ki 0.068000±n/a nM
Citation Ashwood VBrownhill VHigginbottom MHorwell DCHughes JLewthwaite RAMcKnight ATPinnock RDPritchard MCSuman-Chauhan NWebb CWilliams SC PD 176252--the first high affinity non-peptide gastrin-releasing peptide (BB2) receptor antagonist. Bioorg Med Chem Lett 8:2589-94 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
NMBR
Name:Neuromedin B receptor
Synonyms:Bombesin 1 | NMB-R | Neuromedin B receptor | Neuromedin-B receptor | Neuromedin-B-preferring bombesin receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43447.11
Organism:Homo sapiens (Human)
Description:Bombesin 1 NMBR 0::P28336
Residue:390
Sequence:
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP
VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV
FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI
KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV
RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071745
n/a
NameBDBM50071745
Synonyms:CHEMBL403317 | Compound NMB | Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2(Neuromedin B) | NMB
TypeSmall organic molecule
Emp. Form.C52H73N15O12S
Mol. Mass.1132.294
SMILESCSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CN)[C@@H](C)O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: