Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase A
LigandBDBM50078120
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32826
Ki 0±n/a nM
Citation Chen HRoques BPFournié-Zaluski MC Design of the first highly potent and selective aminopeptidase N (EC 3.4.11.2) inhibitor. Bioorg Med Chem Lett 9:1511-6 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase A
Name:Aminopeptidase A
Synonyms:APA | CD_antigen=CD249 | EAP | Glutamyl aminopeptidase
Type:PROTEIN
Mol. Mass.:108259.08
Organism:Sus scrofa
Description:ChEMBL_32826
Residue:942
Sequence:
MSTDSKRYCIKTKHVAIICAAVVAVGLIVGLSVGLTRSCDSKDGGQGTTQSPSHLPPTSS
PPQDQGVCPASEDESGNWRDFRLPDFINPVHYDLQVKPLLEQDTYTGTVNISINVTSPTQ
HLWLHLRETRITQLPVLWRPSGEQVQVRRCFEYKKQEYVVVEAEEELAPNSGEGLYHLTM
EFAGWLNGSLVGFYRTTYVEKGQIKSIAATDHEPTDARKSFPCFDEPNKKATYTISIIHP
KEYKALSNMPVEKEESVDDIWTQTTFQKSVPMSTYLVCFAVHQFDSVTRTSRSGKPLTIY
VQPEQKHTAEYAANITKSVFDYFEDYFAMEYSLPKLDKIAIPDFGTGAMENWGLITYRET
NLLYDPNESASSNQQRVAAVVAHELVHQWFGNIVTMEWWEDLWLNEGFASFFEFLGVDHA
EKEWQMRDQILLEDVLPVQEDDSLISSHPIVVTVSTPAEITSVFDGISYSKGASILRMLE
DWITPEKFQKGCQEYLKKFEFKNAKTSDFWEALEEASNLPVKEVMDTWTNQMGYPVLNVE
DMRIISQKRFLLDPNANSSEPHSVFGYTWNIPVRWTNDNESTITIYNRSETGGITLNSSN
PNGNAFLKINPDHIGFYRVNYEVSTWEWIATNLSLNHKDFSTADRASLIDDAFALARAQL
LNYKEALNLTKYLKMEDEYLPWQRVISAVTYIISMFEDDKELYPMIEKYFRDQVKPIADS
LGWNDNGDHLTKLLRASVLGFACKMGDSNALNNASHLFEQWLTGTVSLPVNLRLLVYRYG
MQNSGNETSWNYTLKQYQETSLAQEKEKLLYGLASVKNVALLSRYLDLLKDPNVIKSQDV
FTVIRYISYNSYGKTMAWNWIQLNWEYLVNRYTLNDRNLGRIVTIAEPFNTELQLWQMES
FFKRYPEAGAGEKPREQVLETVKNNIEWLKQNRDTIRDWFFN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078120
n/a
NameBDBM50078120
Synonyms:(R)-1-{[(S)-2-((S)-1-Carboxy-1-methyl-2-phenyl-ethylcarbamoyl)-3-phenyl-propyl]-hydroxy-phosphinoyl}-ethyl-ammonium
TypeSmall organic molecule
Emp. Form.C22H30N2O5P
Mol. Mass.433.4572
SMILESC[C@H]([NH3+])P(O)(=O)C[C@@H](Cc1ccccc1)C(=O)N[C@@](C)(Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: