| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50082339 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_135943 (CHEMBL744713) |
|---|
| Kd | 3500±n/a nM |
|---|
| Citation |  Thomas, JB; Herault, XM; Rothman, RB; Burgess, JP; Mascarella, SW; Xu, H; Horel, RB; Dersch, CM; Carroll, FI (+/-)-4-[(N-allyl-cis-3-methyl-4-piperidinyl)phenylamino]-N,N-diethylbenzamide displays selective binding for the delta opioid receptor. Bioorg Med Chem Lett9:3053-6 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50082339 |
|---|
| n/a |
|---|
| Name | BDBM50082339 |
|---|
| Synonyms: | 4-[((S)-1-Allyl-3-methyl-piperidin-4-yl)-phenyl-amino]-N,N-diethyl-benzamide | CHEMBL430475 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H35N3O |
|---|
| Mol. Mass. | 405.5756 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)N([C@H]1CCN(CC=C)CC1C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
