| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50083636 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138732 (CHEMBL747754) |
|---|
| Kd | 4667±n/a nM |
|---|
| Citation |  Thomas, JB; Atkinson, RN; Herault, XM; Rothman, RB; Mascarella, SW; Dersch, CM; Xu, H; Horel, RB; Carroll, FI Optically pure (-)-4-[(N-allyl-3-methyl-4-piperidinyl)phenyl-amino]-N,N-diethylbenzami de displays selective binding and full agonist activity for the delta opioid receptor. Bioorg Med Chem Lett9:3347-50 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50083636 |
|---|
| n/a |
|---|
| Name | BDBM50083636 |
|---|
| Synonyms: | 4-[(1-Allyl-3-methyl-piperidin-4-yl)-phenyl-amino]-N,N-diethyl-benzamide | CHEMBL115730 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H35N3O |
|---|
| Mol. Mass. | 405.5756 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)N(C1CCN(CC=C)CC1C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
