Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50076001 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_221911 |
---|
Ki | 0.700000±n/a nM |
---|
Citation | Husbands, SM; Breeden, SW; Grivas, K; Lewis, JW Ring constrained analogues of the orvinols: the furanomorphides. Bioorg Med Chem Lett9:831-4 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50076001 |
---|
n/a |
---|
Name | BDBM50076001 |
Synonyms: | 3-cyclopropylmethyl-18-methyl-(15S)-13,16-dioxa-3-azaheptacyclo[13.5.2.12,8.01,6.06,14.07,12.015,19]tricosa-7,9,11-trien-11-ol | CHEMBL349636 |
Type | Small organic molecule |
Emp. Form. | C25H31NO3 |
Mol. Mass. | 393.5185 |
SMILES | C[C@@H]1CO[C@@]23CCC4(C[C@H]12)C1Cc2ccc(O)c5O[C@@H]3C4(CCN1CC1CC1)c25 |TLB:24:23:7:28.12.11,17:28:7:23.21.22,THB:6:7:28.12.11:23.21.22| |
Structure |
|