| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50076003 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_221911 |
|---|
| Ki | 0.200000±n/a nM |
|---|
| Citation |  Husbands, SM; Breeden, SW; Grivas, K; Lewis, JW Ring constrained analogues of the orvinols: the furanomorphides. Bioorg Med Chem Lett9:831-4 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50076003 |
|---|
| n/a |
|---|
| Name | BDBM50076003 |
|---|
| Synonyms: | 3-cyclopropylmethyl-18,18-dimethyl-(15S)-13,16-dioxa-3-azaheptacyclo[13.5.2.12,8.01,6.06,14.07,12.015,19]tricosa-7,9,11-trien-11-ol | CHEMBL353876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H37NO3 |
|---|
| Mol. Mass. | 435.5983 |
|---|
| SMILES | CC1(C)OC23CCC4(CC2C1(C)C)C1Cc2ccc(O)c5OC3C4(CCN1CC1CC1)c25 |TLB:27:26:7:31.15.14,20:31:7:26.24.25,THB:6:7:31.15.14:26.24.25| |
|---|
| Structure | 
|
|---|
Search and Browse
