Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50354578
Substrate/Competitorn/a
Meas. Tech.ChEBML_221911
Ki 1.3±n/a nM
Citation Husbands SMBreeden SWGrivas KLewis JW Ring constrained analogues of the orvinols: the furanomorphides. Bioorg Med Chem Lett 9:831-4 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354578
n/a
NameBDBM50354578
Synonyms:BUPRENORPHINE | US9315514, Buprenorphine
TypeSmall organic molecule
Emp. Form.C29H41NO4
Mol. Mass.467.6401
SMILESCO[C@@]12CC[C@@]3(C[C@@H]1[C@](C)(O)C(C)(C)C)[C@H]1Cc4ccc(O)c5O[C@@H]2[C@]3(CCN1CC1CC1)c45 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: