| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50093010 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49780 (CHEMBL884340) |
|---|
| IC50 | >300000±n/a nM |
|---|
| Citation |  Llinàs-Brunet, M; Bailey, M; Fazal, G; Ghiro, E; Gorys, V; Goulet, S; Halmos, T; Maurice, R; Poirier, M; Poupart, MA; Rancourt, J; Thibeault, D; Wernic, D; Lamarre, D Highly potent and selective peptide-based inhibitors of the hepatitis C virus serine protease: towards smaller inhibitors. Bioorg Med Chem Lett10:2267-70 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27713.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_10909 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50093010 |
|---|
| n/a |
|---|
| Name | BDBM50093010 |
|---|
| Synonyms: | (S)-2-{[(2S,4R)-1-((S)-2-{(S)-2-[(R)-2-((S)-2-Acetylamino-3-carboxy-propionylamino)-4-carboxy-butyrylamino]-2-cyclohexyl-acetylamino}-3-methyl-butyryl)-4-(naphthalen-2-ylmethoxy)-pyrrolidine-2-carbonyl]-amino}-pentanoic acid | CHEMBL432156 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C45H62N6O13 |
|---|
| Mol. Mass. | 895.0062 |
|---|
| SMILES | CCC[C@H](NC(=O)[C@@H]1C[C@H](CN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(C)=O)C1CCCCC1)C(C)C)OCc1ccc2ccccc2c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
