Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM50087265
Substrate/Competitorn/a
Meas. Tech.ChEBML_45274
Ki 4±n/a nM
Citation Renzi GScozzafava ASupuran CT Carbonic anhydrase inhibitors: topical sulfonamide antiglaucoma agents incorporating secondary amine moieties. Bioorg Med Chem Lett 10:673-6 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087265
n/a
NameBDBM50087265
Synonyms:5-{4-[(7-Chloro-2-oxo-2H-chromen-4-ylmethyl)-amino]-benzenesulfonylamino}-[1,3,4]thiadiazole-2-sulfonic acid amide | CHEMBL161438
TypeSmall organic molecule
Emp. Form.C18H14ClN5O6S3
Mol. Mass.527.982
SMILESNS(=O)(=O)c1nnc(NS(=O)(=O)c2ccc(NCc3cc(=O)oc4cc(Cl)ccc34)cc2)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: