| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50103876 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_205216 (CHEMBL816490) |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Fan, G; Mar, W; Park, MK; Choi, EW; Kim, K; Kim, S A novel class of inhibitors for steroid 5alpha-reductase: synthesis and evaluation of umbelliferone derivatives. Bioorg Med Chem Lett11:2361-3 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50103876 |
|---|
| n/a |
|---|
| Name | BDBM50103876 |
|---|
| Synonyms: | 7-(1,1-Dimethyl-allyloxy)-chromen-2-one | CHEMBL311624 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H14O3 |
|---|
| Mol. Mass. | 230.2592 |
|---|
| SMILES | CC(C)(Oc1ccc2ccc(=O)oc2c1)C=C |
|---|
| Structure | 
|
|---|
Search and Browse
