Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50174558 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_205216 (CHEMBL816490) |
---|
IC50 | >123000±n/a nM |
---|
Citation | Fan, G; Mar, W; Park, MK; Choi, EW; Kim, K; Kim, S A novel class of inhibitors for steroid 5alpha-reductase: synthesis and evaluation of umbelliferone derivatives. Bioorg Med Chem Lett11:2361-3 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50174558 |
---|
n/a |
---|
Name | BDBM50174558 |
Synonyms: | 7-hydroxy-2H-1-benzopyran-2-one | 7-hydroxy-2H-chromen-2-one | CHEMBL51628 | Coumarin derivative, 3a | beta-umbelliferone | hydrangin | skimmetin | umbelliferone |
Type | Small organic molecule |
Emp. Form. | C9H6O3 |
Mol. Mass. | 162.1421 |
SMILES | Oc1ccc2ccc(=O)oc2c1 |
Structure |
|