Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50105492
Substrate/Competitorn/a
Meas. Tech.ChEBML_145282
Ki 0.270000±n/a nM
Citation Neumeyer JLGu XHvan Vliet LADeNunzio NJRusovici DECohen DJNegus SSMello NKBidlack JM Mixed kappa agonists and mu agonists/antagonists as potential pharmacotherapeutics for cocaine abuse: synthesis and opioid receptor binding affinity of N-substituted derivatives of morphinan. Bioorg Med Chem Lett 11:2735-40 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105492
n/a
NameBDBM50105492
Synonyms:3-[5-hydroxy-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-17-yl]-1-(2-thienyl)-1-propanone | CHEMBL327885 | MCL-114
TypeSmall organic molecule
Emp. Form.C23H27NO2S
Mol. Mass.381.531
SMILESOc1ccc2c(C[C@@H]3[C@@H]4CCCCC24CCN3CCC(=O)c2cccs2)c1 |THB:17:16:8:4.5.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: