| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50105492 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145282 |
|---|
| Ki | 0.270000±n/a nM |
|---|
| Citation |  Neumeyer, JL; Gu, XH; van Vliet, LA; DeNunzio, NJ; Rusovici, DE; Cohen, DJ; Negus, SS; Mello, NK; Bidlack, JM Mixed kappa agonists and mu agonists/antagonists as potential pharmacotherapeutics for cocaine abuse: synthesis and opioid receptor binding affinity of N-substituted derivatives of morphinan. Bioorg Med Chem Lett11:2735-40 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50105492 |
|---|
| n/a |
|---|
| Name | BDBM50105492 |
|---|
| Synonyms: | 3-[5-hydroxy-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-17-yl]-1-(2-thienyl)-1-propanone | CHEMBL327885 | MCL-114 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27NO2S |
|---|
| Mol. Mass. | 381.531 |
|---|
| SMILES | Oc1ccc2c(C[C@@H]3[C@@H]4CCCCC24CCN3CCC(=O)c2cccs2)c1 |THB:17:16:8:4.5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
