Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50105492 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_145282 |
---|
Ki | 0.270000±n/a nM |
---|
Citation | Neumeyer, JL; Gu, XH; van Vliet, LA; DeNunzio, NJ; Rusovici, DE; Cohen, DJ; Negus, SS; Mello, NK; Bidlack, JM Mixed kappa agonists and mu agonists/antagonists as potential pharmacotherapeutics for cocaine abuse: synthesis and opioid receptor binding affinity of N-substituted derivatives of morphinan. Bioorg Med Chem Lett11:2735-40 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50105492 |
---|
n/a |
---|
Name | BDBM50105492 |
Synonyms: | 3-[5-hydroxy-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-17-yl]-1-(2-thienyl)-1-propanone | CHEMBL327885 | MCL-114 |
Type | Small organic molecule |
Emp. Form. | C23H27NO2S |
Mol. Mass. | 381.531 |
SMILES | Oc1ccc2c(C[C@@H]3[C@@H]4CCCCC24CCN3CCC(=O)c2cccs2)c1 |THB:17:16:8:4.5.6| |
Structure |
|