| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50105497 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_147151 |
|---|
| Ki | 2.6±n/a nM |
|---|
| Citation |  Neumeyer, JL; Gu, XH; van Vliet, LA; DeNunzio, NJ; Rusovici, DE; Cohen, DJ; Negus, SS; Mello, NK; Bidlack, JM Mixed kappa agonists and mu agonists/antagonists as potential pharmacotherapeutics for cocaine abuse: synthesis and opioid receptor binding affinity of N-substituted derivatives of morphinan. Bioorg Med Chem Lett11:2735-40 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50105497 |
|---|
| n/a |
|---|
| Name | BDBM50105497 |
|---|
| Synonyms: | 2-[5-hydroxy-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-17-yl]ethyl cyanide | CHEMBL93731 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24N2O |
|---|
| Mol. Mass. | 296.4067 |
|---|
| SMILES | Oc1ccc2c(C[C@@H]3[C@@H]4CCCCC24CCN3CCC#N)c1 |THB:17:16:8:4.5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
