Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50105588 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_80617 |
---|
IC50 | >100000±n/a nM |
---|
Citation | Tillekeratne, LM; Sherette, A; Grossman, P; Hupe, L; Hupe, D; Hudson, RA Simplified catechin-gallate inhibitors of HIV-1 reverse transcriptase. Bioorg Med Chem Lett11:2763-7 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50105588 |
---|
n/a |
---|
Name | BDBM50105588 |
Synonyms: | 2,3,4-Trihydroxy-benzoic acid chroman-3-yl ester | CHEMBL93249 |
Type | Small organic molecule |
Emp. Form. | C16H14O6 |
Mol. Mass. | 302.2788 |
SMILES | Oc1ccc(C(=O)OC2COc3ccccc3C2)c(O)c1O |
Structure |
|