Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptors; D2 & D4
LigandBDBM50112787
Substrate/Competitorn/a
Meas. Tech.ChEBML_60687
Ki 12±n/a nM
Citation Cha MYChoi BCKang KHPae ANChoi KICho YSKoh HYLee HYJung DKong JY Design and synthesis of a piperazinylalkylisoxazole library for subtype selective dopamine receptor ligands. Bioorg Med Chem Lett 12:1327-30 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptors; D2 & D4
Name:D2-like dopamine receptor
Synonyms:D(2C) dopamine receptor | D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112787
n/a
NameBDBM50112787
Synonyms:1-(2-Ethoxy-phenyl)-4-[4-(3-thiophen-2-yl-isoxazol-5-yl)-butyl]-piperazine; hydrochloride | CHEMBL557829
TypeSmall organic molecule
Emp. Form.C23H29N3O2S
Mol. Mass.411.56
SMILESCCOc1ccccc1N1CCN(CCCCc2cc(no2)-c2cccs2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: