| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50114969 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79805 |
|---|
| IC50 | 7740±n/a nM |
|---|
| Citation |  Murphy, PV; O'Brien, JL; Gorey-Feret, LJ; Smith, AB Structure-based design and synthesis of HIV-1 protease inhibitors employing beta-D-mannopyranoside scaffolds. Bioorg Med Chem Lett12:1763-6 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50114969 |
|---|
| n/a |
|---|
| Name | BDBM50114969 |
|---|
| Synonyms: | CHEMBL51564 | N-[(3R,5R,6R)-4-Benzyloxy-5-hydroxy-6-methoxy-3-(4-methoxy-phenoxy)-tetrahydro-pyran-2-ylmethyl]-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29NO7 |
|---|
| Mol. Mass. | 431.4789 |
|---|
| SMILES | CO[C@@H]1OC(CNC(C)=O)[C@@H](Oc2ccc(OC)cc2)C(OCc2ccccc2)[C@H]1O |
|---|
| Structure | 
|
|---|
Search and Browse
