Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-specific 3',5'-cyclic phosphodiesterase
LigandBDBM50130021
Substrate/Competitorn/a
Meas. Tech.ChEBML_155194
IC50 0.220000±n/a nM
Citation Ukita TNakamura YKubo AYamamoto YMoritani YSaruta KHigashijima TKotera JFujishige KTakagi MKikkawa KOmori K 1,7- and 2,7-naphthyridine derivatives as potent and highly specific PDE5 inhibitors. Bioorg Med Chem Lett 13:2341-5 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cGMP-specific 3',5'-cyclic phosphodiesterase
Name:Phosphodiesterase 5A
Synonyms:CGB-PDE | PDE5 | PDE5A | cGMP-binding cGMP-specific phosphodiesterase | cGMP-specific 3'',5''-cyclic phosphodiesterase
Type:PROTEIN
Mol. Mass.:98285.03
Organism:Canis lupus familiaris
Description:ChEMBL_105565
Residue:865
Sequence:
MERGSPGAGAARLPRDQDSVEAWLDDHRDFTFSYFVKKATREMVNAWFAERVHTIPVCKE
GIRGHAESCSCSSQQSSRADSSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLADSEK
KEQMPLTPPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKLPDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETKELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIK
RRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKTLINGESSQAKRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130021
n/a
NameBDBM50130021
Synonyms:7-(2-Methyl-pyridin-4-ylmethyl)-8-oxo-2-(pyridin-2-ylmethoxy)-5-(3,4,5-trimethoxy-phenyl)-7,8-dihydro-[1,7]naphthyridine-6-carboxylic acid methyl ester with 2moles of hydrochloride | CHEMBL540031
TypeSmall organic molecule
Emp. Form.C32H30N4O7
Mol. Mass.582.6032
SMILESCOC(=O)c1c(-c2cc(OC)c(OC)c(OC)c2)c2ccc(OCc3ccccn3)nc2c(=O)n1Cc1ccnc(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: