Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate kinase
LigandBDBM50132286
Substrate/Competitorn/a
Meas. Tech.ChEBML_208218
Ki 110000±n/a nM
Citation Vanheusden VVan Rompaey PMunier-Lehmann HPochet SHerdewijn PVan Calenbergh S Thymidine and thymidine-5'-O-monophosphate analogues as inhibitors of Mycobacterium tuberculosis thymidylate kinase. Bioorg Med Chem Lett 13:3045-8 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thymidylate kinase
Name:Thymidylate kinase
Synonyms:TMPK | Thymidine monophosphate kinase | dTMP kinase
Type:PROTEIN
Mol. Mass.:22636.29
Organism:Mycobacterium tuberculosis
Description:ChEMBL_208218
Residue:214
Sequence:
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132286
n/a
NameBDBM50132286
Synonyms:(R)-5-Hydroxymethyl-1-((4S,5R)-4-hydroxy-5-methylphosphate-tetrahydro-furan-2-yl)-1H-pyrimidine-2,4-dione
TypeSmall organic molecule
Emp. Form.C10H13N2O9P
Mol. Mass.336.1931
SMILESOCc1cn([C@H]2C[C@H](O)[C@@H](COP([O-])([O-])=O)O2)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: