| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate kinase |
|---|
| Ligand | BDBM50132295 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_208218 |
|---|
| Ki | 560000±n/a nM |
|---|
| Citation |  Vanheusden, V; Van Rompaey, P; Munier-Lehmann, H; Pochet, S; Herdewijn, P; Van Calenbergh, S Thymidine and thymidine-5'-O-monophosphate analogues as inhibitors of Mycobacterium tuberculosis thymidylate kinase. Bioorg Med Chem Lett13:3045-8 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thymidylate kinase |
|---|
| Name: | Thymidylate kinase |
|---|
| Synonyms: | KTHY_MYCTU | TMPK | Thymidine monophosphate kinase | dTMP kinase | tmk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22636.29 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_208218 |
|---|
| Residue: | 214 |
|---|
| Sequence: | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
|
|
|
|---|
| BDBM50132295 |
|---|
| n/a |
|---|
| Name | BDBM50132295 |
|---|
| Synonyms: | 1-((2R,3R,4S,5R)-3,4-dihydroxy-5-methyl-tetrahydrofuran-2-yl)-5-fluoropyrimidine-2,4(1H,3H)-dione | 1-((2R,5R)-3,4-Dihydroxy-5-methyl-tetrahydro-furan-2-yl)-5-fluoro-1H-pyrimidine-2,4-dione | 5'-Deoxy-5-Fluorouridine (5'-Dfur) | CHEMBL1130 | DOXIFLURIDINE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H11FN2O5 |
|---|
| Mol. Mass. | 246.1924 |
|---|
| SMILES | C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cc(F)c(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
