Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetImmunoglobulin epsilon Fc receptor
LigandBDBM50132433
Substrate/Competitorn/a
Meas. Tech.ChEBML_163803
EC50 110±n/a nM
Citation Lai JYCox PJPatel RSadiq SAldous DJThurairatnam SSmith KWheeler DJagpal SParveen SFenton GHarrison TKMcCarthy CBamborough P Potent small molecule inhibitors of spleen tyrosine kinase (Syk). Bioorg Med Chem Lett 13:3111-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Immunoglobulin epsilon Fc receptor
Name:Immunoglobulin epsilon Fc receptor
Synonyms:BLAST-2 | CD_antigen=CD23 | Fc-epsilon-RII | Immunoglobulin E-binding factor | Low affinity immunoglobulin epsilon Fc receptor | Low affinity immunoglobulin epsilon Fc receptor membrane-bound form | Low affinity immunoglobulin epsilon Fc receptor soluble form | Lymphocyte IgE receptor
Type:PROTEIN
Mol. Mass.:36461.84
Organism:Homo sapiens (Human)
Description:ChEMBL_88888
Residue:321
Sequence:
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132433
n/a
NameBDBM50132433
Synonyms:3-[1-(5-Methoxy-1-methyl-1H-indol-3-yl)-meth-(Z)-ylidene]-2-oxo-2,3-dihydro-1H-indole-5-sulfonic acid methylamide | CHEMBL104519
TypeSmall organic molecule
Emp. Form.C20H19N3O4S
Mol. Mass.397.448
SMILESCNS(=O)(=O)c1ccc2NC(=O)\C(=C/c3cn(C)c4ccc(OC)cc34)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: