Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 5
LigandBDBM50158348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201457
EC50 9.20±n/a nM
Citation Clemens JJDavis MDLynch KRMacdonald TL Synthesis of para-alkyl aryl amide analogues of sphingosine-1-phosphate: discovery of potent S1P receptor agonists. Bioorg Med Chem Lett 13:3401-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 5
Name:Sphingosine 1-phosphate receptor 5
Synonyms:Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41796.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:398
Sequence:
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158348
n/a
NameBDBM50158348
Synonyms:(2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate | (2S,3R,4E)-2-amino-4-octadecene-1,3-diol 1-(dihydrogen phosphate) | CHEMBL225155 | sphingosine 1-phosphate | sphingosine-1-phosphate
TypeSmall organic molecule
Emp. Form.C18H38NO5P
Mol. Mass.379.4718
SMILESCCCCCCCCCCCCC\C=C\[C@@H](O)[C@@H](N)COP(O)(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: