Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM50125411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158334
Ki 2.5±n/a nM
Citation Billot XChateauneuf AChauret NDenis DGreig GMathieu MCMetters KMSlipetz DMYoung RN Discovery of a potent and selective agonist of the prostaglandin EP4 receptor. Bioorg Med Chem Lett 13:1129-32 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125411
n/a
NameBDBM50125411
Synonyms:(R)-5-((E)-(R)-3-Hydroxy-4-phenyl-but-1-enyl)-1-[6-(1H-tetrazol-5-yl)-hexyl]-pyrrolidin-2-one | CHEMBL1794823 | CHEMBL280247
TypeSmall organic molecule
Emp. Form.C21H29N5O2
Mol. Mass.383.4873
SMILESO[C@H](Cc1ccccc1)\C=C\[C@H]1CCC(=O)N1CCCCCCc1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: