Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
LigandBDBM50148391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201322
IC50>10000±n/a nM
Citation Hale JJDoherty GToth LLi ZMills SGHajdu RAnn Keohane CRosenbach MMilligan JShei GJChrebet GBergstrom JCard DRosen HMandala S The discovery of 3-(N-alkyl)aminopropylphosphonic acids as potent S1P receptor agonists. Bioorg Med Chem Lett 14:3495-9 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:S1P2 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38883.16
Organism:Homo sapiens (Human)
Description:Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay.
Residue:353
Sequence:
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148391
n/a
NameBDBM50148391
Synonyms:CHEMBL325193 | {3-[2-(4-Octyl-phenyl)-ethylamino]-propyl}-phosphonic acid
TypeSmall organic molecule
Emp. Form.C19H34NO3P
Mol. Mass.355.4519
SMILESCCCCCCCCc1ccc(CCNCCCP(O)(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: