Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM50080733
Substrate/Competitorn/a
Meas. Tech.ChEBML_45453
Ki 2.4±n/a nM
Citation Lehtonen JMParkkila SVullo DCasini AScozzafava ASupuran CT Carbonic anhydrase inhibitors. Inhibition of cytosolic isozyme XIII with aromatic and heterocyclic sulfonamides: a novel target for the drug design. Bioorg Med Chem Lett 14:3757-62 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080733
n/a
NameBDBM50080733
Synonyms:4-(4-aminophenylsulfonamido)-1-benzenesulfonamide | 4-amino-N-(4-sulfamoylphenyl)benzenesulfonamide | 4-amino-N-[4-(aminosulfonyl)phenyl]benzenesulfonamide | 4-amino-bis-benzenesulfonamide | CHEMBL269122 | cid_68351
TypeSmall organic molecule
Emp. Form.C12H13N3O4S2
Mol. Mass.327.379
SMILESNc1ccc(cc1)S(=O)(=O)Nc1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: