| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 13 |
|---|
| Ligand | BDBM10872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_45453 |
|---|
| Ki | 1.3±n/a nM |
|---|
| Citation |  Lehtonen, JM; Parkkila, S; Vullo, D; Casini, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Inhibition of cytosolic isozyme XIII with aromatic and heterocyclic sulfonamides: a novel target for the drug design. Bioorg Med Chem Lett14:3757-62 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 13 |
|---|
| Name: | Carbonic anhydrase 13 |
|---|
| Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29522.80 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Murine cloned isozyme |
|---|
| Residue: | 262 |
|---|
| Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
|---|
| BDBM10872 |
|---|
| n/a |
|---|
| Name | BDBM10872 |
|---|
| Synonyms: | 4-amino-N-[2-(4-sulfamoylphenyl)ethyl]benzene-1-sulfonamide | CHEMBL7146 | aromatic/heteroaromatic sulfonamide 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H17N3O4S2 |
|---|
| Mol. Mass. | 355.432 |
|---|
| SMILES | Nc1ccc(cc1)S(=O)(=O)NCCc1ccc(cc1)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
