Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-4/beta-2 subunit
LigandBDBM10759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143730
Ki 45±n/a nM
Citation Xiao YBaydyuk MWang HPDavis HEKellar KJ Pharmacology of the agonist binding sites of rat neuronal nicotinic receptor subtypes expressed in HEK 293 cells. Bioorg Med Chem Lett 14:1845-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-4/beta-2 subunit
Name:Neuronal acetylcholine receptor protein alpha-4/beta-2 subunit
Synonyms:Neuronal acetylcholine receptor alpha4/beta2 | Neuronal acetylcholine receptor; alpha4/beta2
Type:n/a
Mol. Mass.:n/a
Description:n/a
Components:This complex has 0 components.
Component 1
Name:Neuronal acetylcholine receptor
Synonyms:CHRNA4 | Cholinergic, Nicotinic Alpha4Beta2 | Cholinergic, Nicotinic Alpha4Beta4 | Neuronal acetylcholine receptor (alpha4beta2 nAChR) | Neuronal acetylcholine receptor protein alpha-4 subunit | Neuronal acetylcholine receptor subunit alpha 4 beta 2 | Neuronal acetylcholine receptor subunit alpha-4
Type:Enzyme
Mol. Mass.:70196.44
Organism:Rattus norvegicus (Rat)
Description:P09483
Residue:630
Sequence:
MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
PTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLF
MKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAV
ETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQ
EAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKE
PSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFIIVCLLGTVGLFLPPWLAAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:N-alpha 1 | Neuronal acetylcholine receptor | Neuronal acetylcholine receptor non-alpha-1 chain | Neuronal acetylcholine receptor subunit beta-2
Type:Enzyme
Mol. Mass.:56910.32
Organism:Rattus norvegicus (Rat)
Description:P12390
Residue:500
Sequence:
MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLM
VSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYN
NADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRT
EIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINL
IIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYL
MFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRL
RLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSC
GLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPL
FQNYTATTFLHPDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
n/a
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: