Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM10755
Substrate/Competitorn/a
Meas. Tech.ChEBML_3481
EC50 12000±n/a nM
Citation Papke RLPorter Papke JKRose GM Activity of alpha7-selective agonists at nicotinic and serotonin 5HT3 receptors expressed in Xenopus oocytes. Bioorg Med Chem Lett 14:1849-53 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT3 | 5-hydroxytryptamine receptor 3A | Zacopride site-R
Type:Enzyme Catalytic Domain
Mol. Mass.:55428.70
Organism:RAT
Description:5-HT3 HTR3A RAT::P35563
Residue:483
Sequence:
MPLCIPQVLLALFLSVLIAQGEGSRRRATQAHSTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTLVSIDVIMYAILNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPSIPYVYVHHQGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQEFSIETSNSYAEMKFY
VVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRHLVLDRIAWLL
CLGEQPMAHRPPATFQANKTDDCSAMGNHCSHVGSPQDLEKTSRSRDSPLPPPREASLAV
RGLLQELSSIRHSLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIW
HYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: