Reaction Details |
| Report a problem with these data |
Target | Cytidine deaminase |
---|
Ligand | BDBM50366985 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52528 (CHEMBL665300) |
---|
Ki | 4000±n/a nM |
---|
Citation | Marquez, VE; Liu, PS; Kelley, JA; Driscoll, JS; McCormack, JJ Synthesis of 1,3-diazepin-2-one nucleosides as transition-state inhibitors of cytidine deaminase. J Med Chem23:713-5 (1980) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytidine deaminase |
---|
Name: | Cytidine deaminase |
Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
Type: | PROTEIN |
Mol. Mass.: | 16129.75 |
Organism: | Mus musculus |
Description: | ChEMBL_52531 |
Residue: | 146 |
Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
BDBM50366985 |
---|
n/a |
---|
Name | BDBM50366985 |
Synonyms: | CHEMBL608656 |
Type | Small organic molecule |
Emp. Form. | C9H16N2O5 |
Mol. Mass. | 232.2337 |
SMILES | OC[C@H]1OC([C@H](O)[C@@H]1O)N1CCNC(=O)C1 |r| |
Structure |
|