| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytidine deaminase |
|---|
| Ligand | BDBM50366987 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52528 (CHEMBL665300) |
|---|
| Ki | 20000±n/a nM |
|---|
| Citation |  Marquez, VE; Liu, PS; Kelley, JA; Driscoll, JS; McCormack, JJ Synthesis of 1,3-diazepin-2-one nucleosides as transition-state inhibitors of cytidine deaminase. J Med Chem23:713-5 (1980) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytidine deaminase |
|---|
| Name: | Cytidine deaminase |
|---|
| Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16129.75 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_52531 |
|---|
| Residue: | 146 |
|---|
| Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
|---|
| BDBM50366987 |
|---|
| n/a |
|---|
| Name | BDBM50366987 |
|---|
| Synonyms: | CHEMBL608479 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H16N2O6 |
|---|
| Mol. Mass. | 260.2438 |
|---|
| SMILES | OC[C@H]1OC([C@H](O)[C@@H]1O)N1CCC(=O)CNC1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
