Reaction Details |
| Report a problem with these data |
Target | Cytidine deaminase |
---|
Ligand | BDBM50367036 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_52526 |
---|
Ki | 34000±n/a nM |
---|
Citation | Liu, PS; Marquez, VE; Driscoll, JS; Fuller, RW; McCormack, JJ Cyclic urea nucleosides. Cytidine deaminase activity as a function of aglycon ring size. J Med Chem24:662-6 (1981) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytidine deaminase |
---|
Name: | Cytidine deaminase |
Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
Type: | PROTEIN |
Mol. Mass.: | 16129.75 |
Organism: | Mus musculus |
Description: | ChEMBL_52531 |
Residue: | 146 |
Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
BDBM50367036 |
---|
n/a |
---|
Name | BDBM50367036 |
Synonyms: | CHEMBL609349 |
Type | Small organic molecule |
Emp. Form. | C11H20N2O5 |
Mol. Mass. | 260.2869 |
SMILES | OC[C@H]1OC([C@H](O)[C@@H]1O)N1CCCCCNC1=O |r| |
Structure |
|