Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepininephrine & dopamine
LigandBDBM50002012
Substrate/Competitorn/a
Meas. Tech.ChEBML_62002
IC50 93±n/a nM
Citation Bøgesø KP Neuroleptic activity and dopamine-uptake inhibition in 1-piperazino-3-phenylindans. J Med Chem 26:935-47 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepininephrine & dopamine
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:DA transporter | Sodium-dependent dopamine transporter | Sodium-dependent dopamine transporter (DAT)
Type:Multi-pass membrane protein
Mol. Mass.:68749.45
Organism:Rattus norvegicus (rat)
Description:P23977
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002012
n/a
NameBDBM50002012
Synonyms:(trans) 2-{4-[3-(4-Fluoro-phenyl)-6-trifluoromethyl-indan-1-yl]-piperazin-1-yl}-ethanol | 2-{4-[3-(4-Fluoro-phenyl)-6-trifluoromethyl-indan-1-yl]-piperazin-1-yl}-ethanol | CHEMBL1204138 | CHEMBL12628 | tefludazine
TypeSmall organic molecule
Emp. Form.C22H24F4N2O
Mol. Mass.408.4324
SMILESOCCN1CCN(CC1)C1CC(c2ccc(cc12)C(F)(F)F)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: