Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50026972
Substrate/Competitorn/a
Meas. Tech.ChEBML_33039
Ki 226±n/a nM
Citation Remy DCBritcher SFKing SWAnderson PSHunt CARandall WCBélanger PAtkinson JGGirard YRooney CSFuentes JJTotaro JARobinson JLRisley EAWilliams M Synthesis and receptor binding studies relevant to the neuroleptic activities of some 1-methyl-4-piperidylidene-9-substituted-pyrrolo[2,1-b][3]benzazepine derivatives. J Med Chem 26:974-80 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
adrenergic Alpha2
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha-2Da adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha2A | adrenergic Alpha2D
Type:Enzyme Catalytic Domain
Mol. Mass.:49275.13
Organism:BOVINE
Description:adrenergic Alpha2 0 BOVINE::Q28838
Residue:452
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026972
n/a
NameBDBM50026972
Synonyms:11-(1-Methyl-piperidin-4-ylidene)-11H-benzo[d]pyrrolo[1,2-a]azepine | CHEMBL175154
TypeSmall organic molecule
Emp. Form.C19H20N2
Mol. Mass.276.3755
SMILES[#6]-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2cccn2-[#6]=[#6]-c2ccccc-12 |c:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: