Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCerebral cortex alpha adrenergic receptor
LigandBDBM50026970
Substrate/Competitorn/a
Meas. Tech.ChEBML_33098
Ki 80±n/a nM
Citation Remy DCBritcher SFKing SWAnderson PSHunt CARandall WCBélanger PAtkinson JGGirard YRooney CSFuentes JJTotaro JARobinson JLRisley EAWilliams M Synthesis and receptor binding studies relevant to the neuroleptic activities of some 1-methyl-4-piperidylidene-9-substituted-pyrrolo[2,1-b][3]benzazepine derivatives. J Med Chem 26:974-80 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cerebral cortex alpha adrenergic receptor
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha-1C adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1
Type:Enzyme Catalytic Domain
Mol. Mass.:51492.08
Organism:CALF
Description:adrenergic Alpha1 0 CALF
Residue:466
Sequence:
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026970
n/a
NameBDBM50026970
Synonyms:9-Chloro-11-(1-methyl-piperidin-4-ylidene)-6,11-dihydro-5H-benzo[d]pyrrolo[1,2-a]azepine | CHEMBL368357
TypeSmall organic molecule
Emp. Form.C19H21ClN2
Mol. Mass.312.836
SMILES[#6]-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2cccn2-[#6]-[#6]-c2ccc(Cl)cc-12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: