| Reaction Details |
|---|
 | Report a problem with these data |
| Target | cAMP-regulated phosphoprotein 19 |
|---|
| Ligand | BDBM50367174 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_217391 |
|---|
| EC50 | 1870±n/a nM |
|---|
| Citation |  Dandridge, PA; Kaiser, C; Brenner, M; Gaitanopoulos, D; Davis, LD; Webb, RL; Foley, JJ; Sarau, HM Synthesis, resolution, absolute stereochemistry, and enantioselectivity of 3',4'-dihydroxynomifensine. J Med Chem27:28-35 (1984) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| cAMP-regulated phosphoprotein 19 |
|---|
| Name: | cAMP-regulated phosphoprotein 19 |
|---|
| Synonyms: | ARP19_RAT | ARPP-19 | Arpp19 | cAMP-regulated phosphoprotein 19 | cyclic AMP phosphoprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12296.84 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_217391 |
|---|
| Residue: | 112 |
|---|
| Sequence: | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
|
|
|
|---|
| BDBM50367174 |
|---|
| n/a |
|---|
| Name | BDBM50367174 |
|---|
| Synonyms: | CHEMBL1788237 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18N2O2 |
|---|
| Mol. Mass. | 270.3263 |
|---|
| SMILES | CN1C[C@@H](c2ccc(O)c(O)c2)c2cccc(N)c2C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
