Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin-converting enzyme
LigandBDBM50020839
Substrate/Competitorn/a
Meas. Tech.ChEBML_34797
IC50 0.100000±n/a nM
Citation Menard PRSuh JTJones HLoev BNeiss ESWilde JSchwab AMann WS Angiotensin converting enzyme inhibitors. (Mercaptoaroyl)amino acids. J Med Chem 28:328-32 (1985) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin-converting enzyme
Name:Angiotensin-converting enzyme
Synonyms:ACE | Angiotensin-converting enzyme, soluble form | CD_antigen=CD143 | Dipeptidyl carboxypeptidase I | Kininase II
Type:n/a
Mol. Mass.:150405.15
Organism:Oryctolagus cuniculus
Description:n/a
Residue:1310
Sequence:
MGAAPGRRGPRLLRPPPPLLLLLLLLRPPPAALTLDPGLLPGDFAADEAGARLFASSYNS
SAEQVLFRSTAASWAHDTNITAENARRQEEEALLSQEFAEAWGKKAKELYDPVWQNFTDP
ELRRIIGAVRTLGPANLPLAKRQQYNSLLSNMSQIYSTGKVCFPNKTASCWSLDPDLNNI
LASSRSYAMLLFAWEGWHNAVGIPLKPLYQEFTALSNEAYRQDGFSDTGAYWRSWYDSPT
FEEDLERIYHQLEPLYLNLHAYVRRVLHRRYGDRYINLRGPIPAHLLGNMWAQSWESIYD
MVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPEDGR
EVVCHASAWDFYNRKDFRIKQCTQVTMDQLSTVHHEMGHVQYYLQYKDQPVSLRRANPGF
HEAIGDVLALSVSTPAHLHKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRW
GVFSGRTPSSRYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHIPSVTPYIRYFVSFVL
QFQFHQALCMEAGHQGPLHQCDIYQSTRAGAKLRAVLQAGCSRPWQEVLKDMVASDALDA
QPLLDYFQPVTQWLQEQNERNGEVLGWPEYQWRPPLPNNYPEGIDLVTDEAEASRFVEEY
DRSFQAVWNEYAEANWNYNTNITTEASKILLQKNMQIANHTLTYGNWARRFDVSNFQNAT
SKRIIKKVQDLQRAVLPVKELEEYNQILLDMETIYSVANVCRVDGSCLQLEPDLTNLMAT
SRKYDELLWVWTSWRDKVGRAILPYFPKYVEFTNKAARLNGYVDAGDSWRSMYETPTLEQ
DLERLFQELQPLYLNLHAYVGRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVA
PFPSASTMDATEAMIKQGWTPRRMFEEADKFFISLGLLPVPPEFWNKSMLEKPTDGREVV
CHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVALREGANPGFHE
AIGDVLALSVSTPKHLHSINLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLVDEWRWRV
FDGSITKENYNQEWWSLRLKYQGLCPPAPRSQGDFDPGAKFHIPSSVPYIRYFVSFIIQF
QFHEALCKAAGHTGPLHTCDIYQSKEAGKRLADAMKLGYSKPWPEAMKVITGQPNMSASA
MMNYFKPLMDWLLTENGRHGEKLGWPQYTWTPNSARSEGSLPDSGRVNFLGMNLDAQQAR
VGQWVLLFLGVALLLASLGLTQRLFSIRYQSLRQPHHGPQFGSEVELRHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020839
n/a
NameBDBM50020839
Synonyms:CHEMBL324703 | [Cyclopentyl-(2-nitro-benzoyl)-amino]-acetic acid
TypeSmall organic molecule
Emp. Form.C14H16N2O5
Mol. Mass.292.2872
SMILESOC(=O)CN(C1CCCC1)C(=O)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: