Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFolylpoly-gamma-glutamate synthetase
LigandBDBM50011885
Substrate/Competitorn/a
Meas. Tech.ChEBML_68542
Ki 150±n/a nM
Citation Rosowsky AFreisheim JHMoran RGSolan VCBader HWright JERadike-Smith M Methotrexate analogues. 26. Inhibition of dihydrofolate reductase and folylpolyglutamate synthetase activity and in vitro tumor cell growth by methotrexate and aminopterin analogues containing a basic amino acid side chain. J Med Chem 29:655-60 (1986) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Folylpoly-gamma-glutamate synthetase
Name:Folylpoly-gamma-glutamate synthetase
Synonyms:FPGS | Folylpolyglutamate synthase, mitochondrial | Tetrahydrofolate synthase | Tetrahydrofolylpolyglutamate synthase
Type:PROTEIN
Mol. Mass.:64969.76
Organism:Mus musculus
Description:ChEMBL_68680
Residue:587
Sequence:
MSWARSRLCSTLSLAAVSARGATTEGAARRGMSAWPAPQEPGMEYQDAVRTLNTLQTNAS
YLEQVKRQRSDPQAQLEAMEMYLARSGLQVEDLNRLNIIHVTGTKGKGSTCAFTERILRN
YGLKTGFFSSPHMVQVRERIRINGKPISPELFTKHFWCLYNQLEEFKDDSHVSMPSYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKPGVPAFTVVQPEGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGA
HQRSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTVW
PGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLERSKRTDGGSEVHILLFNSTGDRD
SAALLKLLQPCQFDYAVFCPNVTEVSSIGNADQQNFTVTLDQVLLRCLQHQQHWNGLAEK
QASSNLWSSCGPDPAGPGSLLLAPHPPQPTRTSSLVFSCISHALLWISQGRDPIFQPQSL
PRNLLNHPTANSGASILREAAAIHVLVTGSLHLVGGVLKLLDPSMSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011885
n/a
NameBDBM50011885
Synonyms:5-Amino-2-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-pentanoic acid | CHEMBL280864
TypeSmall organic molecule
Emp. Form.C19H23N9O3
Mol. Mass.425.4444
SMILESNCCCC(NC(=O)c1ccc(NCc2cnc3nc(N)nc(N)c3n2)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: