Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50023899 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_53887 |
---|
IC50 | 57±n/a nM |
---|
Citation | Rosowsky, A; Bader, H; Radike-Smith, M; Cucchi, CA; Wick, MM; Freisheim, JH Methotrexate analogues. 28. Synthesis and biological evaluation of new gamma-monoamides of aminopterin and methotrexate. J Med Chem29:1703-9 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50023899 |
---|
n/a |
---|
Name | BDBM50023899 |
Synonyms: | 2-{4-[(2,4-Diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-4-(3,4-dihydroxy-phenylcarbamoyl)-butyric acid | CHEMBL45679 |
Type | Small organic molecule |
Emp. Form. | C25H25N9O6 |
Mol. Mass. | 547.5227 |
SMILES | Nc1nc(N)c2nc(CNc3ccc(cc3)C(=O)NC(CCC(=O)Nc3ccc(O)c(O)c3)C(O)=O)cnc2n1 |
Structure |
|