| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50022232 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54904 |
|---|
| IC50 | 4900±n/a nM |
|---|
| Citation |  Nair, MG; Nanavati, NT; Nair, IG; Kisliuk, RL; Gaumont, Y; Hsiao, MC; Kalman, TI Folate analogues. 26. Syntheses and antifolate activity of 10-substituted derivatives of 5,8-dideazafolic acid and of the poly-gamma-glutamyl metabolites of N10-propargyl-5,8-dideazafolic acid (PDDF). J Med Chem29:1754-60 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50022232 |
|---|
| n/a |
|---|
| Name | BDBM50022232 |
|---|
| Synonyms: | 2-{4-[(2-Amino-4-hydroxy-quinazolin-6-ylmethyl)-ethynyl-amino]-benzoylamino}-5-oxo-pentanoic acid anion |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H20N5O5 |
|---|
| Mol. Mass. | 446.4359 |
|---|
| SMILES | Nc1nc2ccc(CN(C#C)c3ccc(cc3)C(=O)NC(CCC=O)C([O-])=O)cc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
