Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamine synthetase
LigandBDBM50019955
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72016
Ki 75000±n/a nM
Citation Farrington GKKumar AWedler FC Design and synthesis of phosphonate inhibitors of glutamine synthetase. J Med Chem 30:2062-7 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Glutamine synthetase
Name:Glutamine synthetase
Synonyms:Glutamate decarboxylase
Type:Protein
Mol. Mass.:42066.51
Organism:Homo sapiens (Human)
Description:P15104
Residue:373
Sequence:
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019955
n/a
NameBDBM50019955
Synonyms:2-ammonio-4-[hydroxy(phosphonomethyl)phosphoryl]butanoate
TypeSmall organic molecule
Emp. Form.C5H12NO7P2
Mol. Mass.260.0994
SMILES[NH3+]C(CCP([O-])(=O)CP(O)(O)=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: