Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenal dipeptidase
LigandBDBM50023947
Substrate/Competitorn/a
Meas. Tech.ChEBML_216035
Ki 92±n/a nM
Citation Graham DWAshton WTBarash LBrown JEBrown RDCanning LFChen ASpringer JPRogers EF Inhibition of the mammalian beta-lactamase renal dipeptidase (dehydropeptidase-I) by (Z)-2-(acylamino)-3-substituted-propenoic acids. J Med Chem 30:1074-90 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Renal dipeptidase
Name:Renal dipeptidase
Synonyms:Dipeptidase 1 | Leukotriene D4 Alpha | Microsomal dipeptidase
Type:Enzyme Catalytic Domain
Mol. Mass.:44697.32
Organism:GUINEA PIG
Description:Leukotriene D4 Alpha 0 GUINEA PIG::P22412
Residue:409
Sequence:
MWTSWWLWPLVAVCAADQFRDLAVRIMQDTPVIDGHNDLPWQLLNLFNNQLQDPGANLSS
LAHTHTNIPKLKAGFVGGQFWSAYVPCDTQNRDAVKRTLEQIDVIQRMCQAYPETFACVT
SSTGIRQAFREGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYMTLTHSCNTPWADNWLV
DTGDDKAQSQGLSHFGQSVVKEMNRLGVMIDLAHVSVATMRAALKLSQAPVIFSHSSAYS
LCPHRRNVPDDVLQLVKETGSLVMVNFYNDYVSCSAKANLSQVADHLDHIKKVAGAAAVG
FGGDYDGVSRVPSGLEDVSKYPDLVAELLRRQWTEAEVRGALADNLLRVFEAVEQASNHA
QVPGEEPIPLGQLEASCRTNYGYSAAPSLHLPPGSLLASLVPLLLLSLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023947
n/a
NameBDBM50023947
Synonyms:2,11-Bis-[(2,2-dimethyl-cyclopropanecarbonyl)-amino]-dodeca-2,10-dienedioic acid | CHEMBL11961
TypeSmall organic molecule
Emp. Form.C24H36N2O6
Mol. Mass.448.5524
SMILESCC1(C)CC1C(=O)N\C(=C/CCCCCC\C=C(/NC(=O)C1CC1(C)C)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: