Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate synthase (TS)
LigandBDBM50291768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_55096
Ki 2.754E2±n/a nM
Citation Booth RGSelassie CDHansch CSanti DV Quantitative structure-activity relationship of triazine-antifolate inhibition of Leishmania dihydrofolate reductase and cell growth. J Med Chem 30:1218-24 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thymidylate synthase (TS)
Name:Thymidylate synthase (TS)
Synonyms:DHFR-TS
Type:Protein
Mol. Mass.:58691.04
Organism:Leishmania major
Description:P07382
Residue:520
Sequence:
MSRAAARFKIPMPETKADFAFPSLRAFSIVVALDMQHGIGDGESIPWRVPEDMTFFKNQT
TLLRNKKPPTEKKRNAVVMGRKTWESVPVKFRPLKGRLNIVLSSKATVEELLAPLPEGQR
AAAAQDVVVVNGGLAEALRLLARPLYCSSIETAYCVGGAQVYADAMLSPCIEKLQEVYLT
RIYATAPACTRFFPFPPENAATAWDLASSQGRRKSEAEGLEFEICKYVPRNHEERQYLEL
IDRIMKTGIVKEDRTGVGTISLFGAQMRFSLRDNRLPLLTTKRVFWRGVCEELLWFLRGE
TSAQLLADKDIHIWDGNGSREFLDSRGLTENKEMDLGPVYGFQWRHFGADYKGFEANYDG
EGVDQIKLIVETIKTNPNDRRLLVTAWNPCALQKMALPPCHLLAQFYVNTDTSELSCMLY
QRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYRNHVDALKAQLERVP
HAFPTLIFKEERQYLEDYELTDMEVIDYVPHPAIKMEMAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291768
n/a
NameBDBM50291768
Synonyms:6,6-Dimethyl-1-(3-phenylselanylmethyl-phenyl)-1,6-dihydro-[1,3,5]triazine-2,4-diamine | CHEMBL20224
TypeSmall organic molecule
Emp. Form.C18H21N5Se
Mol. Mass.386.35
SMILESCC1(C)N=C(N)N=C(N)N1c1cccc(C[Se]c2ccccc2)c1 |t:3,6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: