Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50022329 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54447 |
---|
IC50 | 32±n/a nM |
---|
Citation | Rosowsky, A; Solan, VC; Forsch, RA; Delcamp, TJ; Baccanari, DP; Freisheim, JH Methotrexate analogues. 30. Dihydrofolate reductase inhibition and in vitro tumor cell growth inhibition by N epsilon-(haloacetyl)-L-lysine and N delta-(haloacetyl)-L-ornithine analogues and an acivicin analogue of methotrexate. J Med Chem30:1463-9 (1987) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50022329 |
---|
n/a |
---|
Name | BDBM50022329 |
Synonyms: | 6-(2-Chloro-acetylamino)-2-{4-[(2,4-diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoylamino}-hexanoic acid | CHEMBL287544 |
Type | Small organic molecule |
Emp. Form. | C23H28ClN9O4 |
Mol. Mass. | 529.979 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CCCCNC(=O)CCl)C(O)=O |
Structure |
|