Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50022831 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54548 (CHEMBL664864) |
---|
Ki | 57±n/a nM |
---|
Citation | Taira, K; Benkovic, SJ Evaluation of the importance of hydrophobic interactions in drug binding to dihydrofolate reductase. J Med Chem31:129-37 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50022831 |
---|
n/a |
---|
Name | BDBM50022831 |
Synonyms: | 6,7-Dimethyl-pteridine-2,4-diamine | CHEMBL29143 |
Type | Small organic molecule |
Emp. Form. | C8H10N6 |
Mol. Mass. | 190.2052 |
SMILES | Cc1nc2nc(N)nc(N)c2nc1C |
Structure |
|